DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and d-cup

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_650235.1 Gene:d-cup / 41580 FlyBaseID:FBgn0038089 Length:219 Species:Drosophila melanogaster


Alignment Length:182 Identity:40/182 - (21%)
Similarity:73/182 - (40%) Gaps:54/182 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ERLYSRFTSLDRNDCGTLSREDLMRIPELA-INPL------CERIVHSFFAESNDD---RVNFRQ 83
            :|...||.|:    .|.|       :|::| :.|.      |..:::..::..|..   |:...|
  Fly     9 DRFNQRFQSV----YGGL-------VPQIARLVPFNDSEVTCILMIYYKYSLQNGPSARRITSSQ 62

  Fly    84 FMNVLAHFRPLRD------------------------NKQSKLNSR--EEKLKFAFKMYDLDDDG 122
            |:|::..|:.|.|                        |..:.|.||  |.|::||:.:||.:..|
  Fly    63 FVNIVIGFQQLYDMDVVDRIVTLIAGGRKHVTPMEFVNYMTILMSRDMERKMEFAYMVYDKNGMG 127

  Fly   123 VISRDELLSILHMMVGANISQDQL----VSIAERTILEADLCCQGKISFEDF 170
            :.......|:....||   ..|::    :.:.:..:|:.|....|.||||::
  Fly   128 INREIISSSVERFFVG---DDDEVLEMRLDMVDFLLLKFDEDQDGYISFEEY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 40/182 (22%)
d-cupNP_650235.1 EF-hand_7 114..180 CDD:290234 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.