DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and sunz

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_649673.1 Gene:sunz / 40811 FlyBaseID:FBgn0037462 Length:220 Species:Drosophila melanogaster


Alignment Length:210 Identity:47/210 - (22%)
Similarity:81/210 - (38%) Gaps:51/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            |.|...|.:.:..|......|.|:.|::..|...|.....|:          |...::.:.|...
  Fly    11 MANNKFLTMYSTLIKSFAASTEFSTNEVVSLLIVFYKYALNN----------RSRMMSTSQLYNL 65

  Fly    66 IVHSF--FAESNDDRVNFRQFMNVLAHFRPLRDNKQSKL------NSREEKLKFAFKMYDLDDDG 122
            .:.||  |..:..||::    ||:....|.:......:|      .|.:|::||||::|......
  Fly    66 FLVSFGIFDVTIIDRIS----MNITQDGRSVSPEAWMRLFCVFFNGSLQERMKFAFEVYTSGGAV 126

  Fly   123 VISRDELLSILHMMVGANISQ----DQLVSIAERTILEADLC----------CQGKISFEDFCKA 173
            |::|:        :||..|.|    |....:.|   |.||:|          ..|.|:||::.:.
  Fly   127 VLNRE--------VVGVAIEQFFTGDDDDEVNE---LRADMCEFIFGKFDTDKDGVIAFEEYAEI 180

  Fly   174 LDRTDVDQKMSIRFL 188
            :.    :|...:.||
  Fly   181 VQ----NQPGLLEFL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 39/171 (23%)
sunzNP_649673.1 EF-hand_7 113..181 CDD:290234 21/78 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.