Sequence 1: | NP_001262295.1 | Gene: | elm / 40695 | FlyBaseID: | FBgn0037358 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998493.1 | Gene: | tesca / 406633 | ZFINID: | ZDB-GENE-040426-2632 | Length: | 218 | Species: | Danio rerio |
Alignment Length: | 199 | Identity: | 61/199 - (30%) |
---|---|---|---|
Similarity: | 107/199 - (53%) | Gaps: | 22/199 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 EEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESN- 75
Fly 76 -------DDRVNFRQFMNVLAHFRPL--RDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLS 131
Fly 132 ILHMMVGA--NISQDQLVSIAERTILEADLCCQGK---------ISFEDFCKALDRTDVDQKMSI 185
Fly 186 RFLN 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
elm | NP_001262295.1 | FRQ1 | 23..173 | CDD:227455 | 54/170 (32%) |
tesca | NP_998493.1 | FRQ1 | 12..>144 | CDD:227455 | 47/132 (36%) |
EF-hand_8 | 83..144 | CDD:290545 | 24/60 (40%) | ||
EFh | 116..185 | CDD:298682 | 18/68 (26%) | ||
EF-hand_7 | 117..184 | CDD:290234 | 17/66 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170592166 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0034 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_105864 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.650 |