DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and tesca

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_998493.1 Gene:tesca / 406633 ZFINID:ZDB-GENE-040426-2632 Length:218 Species:Danio rerio


Alignment Length:199 Identity:61/199 - (30%)
Similarity:107/199 - (53%) Gaps:22/199 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESN- 75
            ::...:.::|||:..||.:|:|||..|.::: .||.||.|..:..||:||:..:|:.:||.:.| 
Zfish    11 QKYQDLADKTGFSTEQIRKLHSRFQYLTQDE-DTLRREHLENLTNLALNPIKRQIIEAFFDKRNL 74

  Fly    76 -------DDRVNFRQFMNVLAHFRPL--RDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLS 131
                   ...:.|.:|:.||:.|||.  |..:..|...:||||:|.|.|:|.|:||||:.||...
Zfish    75 GQNEKGCLQEIGFEEFVTVLSVFRPTKPRTAEDKKKTIKEEKLRFLFNMHDTDNDGVITLDEYRR 139

  Fly   132 ILHMMVGA--NISQDQLVSIAERTILEADLCCQGK---------ISFEDFCKALDRTDVDQKMSI 185
            ::..::.:  .|..:...:|::..:||......|:         |:||.|.:.|...:::.||::
Zfish   140 VVEELLSSYETIEAETAKAISDAAMLEVASVTVGRMSPDEFYEGITFEQFMQILKDIEIETKMNV 204

  Fly   186 RFLN 189
            .|.|
Zfish   205 HFWN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 54/170 (32%)
tescaNP_998493.1 FRQ1 12..>144 CDD:227455 47/132 (36%)
EF-hand_8 83..144 CDD:290545 24/60 (40%)
EFh 116..185 CDD:298682 18/68 (26%)
EF-hand_7 117..184 CDD:290234 17/66 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592166
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105864
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.650

Return to query results.
Submit another query.