DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and tescb

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_991256.1 Gene:tescb / 402993 ZFINID:ZDB-GENE-040426-1903 Length:216 Species:Danio rerio


Alignment Length:210 Identity:62/210 - (29%)
Similarity:110/210 - (52%) Gaps:23/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            ||:..|| ..:.:...:.::|||:..||..|::||..|.:|: .||.|:||..|.:|..||:..:
Zfish     1 MGSFQSL-PDDHQYRTLSQKTGFSLEQIGILHNRFKQLSQNE-DTLRRDDLKTIQDLESNPIRSQ 63

  Fly    66 IVHSFFAESNDDR--------VNFRQFMNVLAHFR-PLRD-NKQSKLNSREEKLKFAFKMYDLDD 120
            |:.:||.:.|..:        :.|.:|:.|:::|| |... .::.:...|..||:|.|.|:|.|:
Zfish    64 IIEAFFDKRNFQKDATGSVQEIGFEEFLTVMSYFRAPAHQITEEQREEIRRAKLRFLFNMHDTDN 128

  Fly   121 DGVISRDELLSILHMMVGAN--ISQDQLVSIAERTILEADLCCQGK---------ISFEDFCKAL 174
            ||.|:.:|...::..::..:  :.::....||:..:||......|.         |:||.|.|.|
Zfish   129 DGTITLEEYRHVVEELLSRSGALGRETAKGIADAAMLEVASITVGPMAPDEFYEGITFEQFLKIL 193

  Fly   175 DRTDVDQKMSIRFLN 189
            ...:::.:|.|||||
Zfish   194 KGVEIETRMHIRFLN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 48/170 (28%)
tescbNP_991256.1 FRQ1 14..>144 CDD:227455 41/130 (32%)
EFh 116..>144 CDD:298682 11/27 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592169
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.