DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and cib2

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_957000.1 Gene:cib2 / 393679 ZFINID:ZDB-GENE-040426-1663 Length:187 Species:Danio rerio


Alignment Length:191 Identity:56/191 - (29%)
Similarity:94/191 - (49%) Gaps:31/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLD--------RNDCGTLSRED------- 50
            ||||.::| .:|::...|:.|.||..:|.||:.|:..|.        .||      .|       
Zfish     1 MGNKQTIF-TDEQLDAYQDCTFFTRKEILRLHGRYHELAPHLVPMDYTND------PDVKVPLAL 58

  Fly    51 LMRIPELAINPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKM 115
            ::.:|||..||...|||.| |:|.....::|..|:::.:..        |::..||.|..:|||:
Zfish    59 IVNMPELKENPFRNRIVES-FSEDGQGNLSFNDFVDMFSVL--------SEMAPRELKAIYAFKI 114

  Fly   116 YDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDR 176
            ||.:.|..|.:::|...|:.:....::.:::..:.|:.|.||||....|:||.||...:.|
Zfish   115 YDFNVDNYICKEDLEKTLNKLTKEELTPEEVNLVCEKAIEEADLDGDNKLSFADFENMISR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 47/164 (29%)
cib2NP_957000.1 EFh 107..174 CDD:238008 21/66 (32%)
EF-hand_7 111..173 CDD:290234 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592189
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.