DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and guca1c

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_919374.1 Gene:guca1c / 373099 ZFINID:ZDB-GENE-030829-1 Length:188 Species:Danio rerio


Alignment Length:83 Identity:24/83 - (28%)
Similarity:45/83 - (54%) Gaps:8/83 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EKLKFAFKMYDLDDDGVISRDELLSILHMMV----GANISQDQLVSIAERTILEADLCCQGKISF 167
            :|||:.||::|.|.:|.|.|||:.:|...:.    ...|..|.:||:....|   |:..:|:::.
Zfish    88 QKLKWYFKLFDQDGNGKIDRDEMETIFKAIQDITRSYEIPPDDIVSLIYERI---DVNNEGELTL 149

  Fly   168 EDFCK-ALDRTDVDQKMS 184
            |:|.. |.:..|:.:.::
Zfish   150 EEFITGAKEHPDIMEMLT 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 22/70 (31%)
guca1cNP_919374.1 FRQ1 6..162 CDD:227455 23/76 (30%)
EFh 53..110 CDD:238008 11/21 (52%)
EFh 89..157 CDD:238008 22/70 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.