DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and rcvrn2

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_956258.1 Gene:rcvrn2 / 335650 ZFINID:ZDB-GENE-030131-7590 Length:193 Species:Danio rerio


Alignment Length:153 Identity:36/153 - (23%)
Similarity:71/153 - (46%) Gaps:23/153 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDC--GTLSREDLMRI-----PELA 58
            |||..|..:..|.:..::..|.|:.|::.:.|..|    :..|  |.::.|:..:|     ||..
Zfish     1 MGNAKSSAMSKEILEDLKLNTKFSENELSQWYENF----QKQCPSGRITPEEFKKIYERFFPECD 61

  Fly    59 INPLCERIVHSFFAESNDD-RVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDG 122
            .....:.:..||  ::||| .::|::::..|         ..:.....|.||::||.::|:|.:|
Zfish    62 TTSYAQHVFRSF--DTNDDGTLDFKEYIIAL---------HMTSTGKTERKLEWAFSLFDVDKNG 115

  Fly   123 VISRDELLSILHMMVGANISQDQ 145
            .|::.|:..|...:......:||
Zfish   116 YITKSEVAEICQAIFKLIPKEDQ 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 30/131 (23%)
rcvrn2NP_956258.1 FRQ1 14..181 CDD:227455 31/140 (22%)
EF-hand_8 40..87 CDD:290545 11/48 (23%)
EFh 65..125 CDD:238008 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.020

Return to query results.
Submit another query.