DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and chp2

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_956130.1 Gene:chp2 / 327599 ZFINID:ZDB-GENE-030131-5810 Length:195 Species:Danio rerio


Alignment Length:195 Identity:93/195 - (47%)
Similarity:129/195 - (66%) Gaps:8/195 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRN-EEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCE 64
            ||:.||..|:. ..:.::.:||||:|..|.|||.||.:||:...|.|..:|...|.|||:||:.:
Zfish     1 MGSSSSTLLKKIPNVDELMQETGFSPAHIIRLYERFEALDKERRGHLCPQDFGAIKELAMNPIGD 65

  Fly    65 RIVHSFFAESNDDRVNFRQFMNVLAHFRPL------RDNKQSKLNSREEKLKFAFKMYDLDDDGV 123
            ||:.:||:... |.|:|..|:.:||||||:      ..|....:|||..||||||::||.|.||.
Zfish    66 RIIDAFFSPGK-DTVDFHTFVKILAHFRPVDKDRPKEPNSPEPINSRSNKLKFAFQLYDQDKDGK 129

  Fly   124 ISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFL 188
            |||||||.:|..|:|..::::||.|||:|||.||||.....||||:|.|:|::.::|.|||||||
Zfish   130 ISRDELLKVLRDMLGLQVTEEQLESIADRTIQEADLDRDDAISFEEFRKSLEKVNIDHKMSIRFL 194

  Fly   189  188
            Zfish   195  194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 75/155 (48%)
chp2NP_956130.1 FRQ1 17..178 CDD:227455 78/161 (48%)
EFh 114..178 CDD:238008 38/63 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592181
Domainoid 1 1.000 77 1.000 Domainoid score I8784
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2469
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.820

Return to query results.
Submit another query.