DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and chp1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_956009.1 Gene:chp1 / 325361 ZFINID:ZDB-GENE-030131-4086 Length:194 Species:Danio rerio


Alignment Length:199 Identity:117/199 - (58%)
Similarity:149/199 - (74%) Gaps:15/199 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            ||:::|..||.|:|.:|::||||:.:||.||||||.|||:.:.|.|||||..||||||||||.:|
Zfish     1 MGSRASSLLREEDIEEIKKETGFSHSQITRLYSRFHSLDKGENGGLSREDFQRIPELAINPLGDR 65

  Fly    66 IVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSK------LNSREEKLKFAFKMYDLDDDGVI 124
            |:::||.| .:|:||||.||..||||||:.||:::|      ||||..||.|||::||||.|..|
Zfish    66 IINAFFPE-GEDQVNFRGFMRTLAHFRPVEDNEKNKDLTGEPLNSRTNKLLFAFRLYDLDRDDKI 129

  Fly   125 SRDELLSILHMMVGANISQDQLVSIAERTILEA----DLCCQGKISFEDFCKALDRTDVDQKMSI 185
            ||||||.:|.||||.|||.:||.|||:|||.||    |:|    |||.:|.|.|::.||:|||||
Zfish   130 SRDELLQVLRMMVGVNISDEQLGSIADRTIQEADTNGDMC----ISFNEFTKVLEKVDVEQKMSI 190

  Fly   186 RFLN 189
            |||:
Zfish   191 RFLH 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 94/159 (59%)
chp1NP_956009.1 FRQ1 1..181 CDD:227455 107/184 (58%)
EFh 113..179 CDD:238008 42/69 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592178
Domainoid 1 1.000 124 1.000 Domainoid score I5494
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5235
Inparanoid 1 1.050 217 1.000 Inparanoid score I3572
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - oto41056
orthoMCL 1 0.900 - - OOG6_105864
Panther 1 1.100 - - LDO PTHR46002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3958
SonicParanoid 1 1.000 - - X2469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.