DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CG32812

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001284770.1 Gene:CG32812 / 31074 FlyBaseID:FBgn0025642 Length:225 Species:Drosophila melanogaster


Alignment Length:204 Identity:64/204 - (31%)
Similarity:109/204 - (53%) Gaps:20/204 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            ||:..|..|...::...|:.||.:..|:|:|::||.||||:..|.|:..||:|||:|::|||..:
  Fly     1 MGSVGSRQLNPVQLCDHQQATGLSAEQLEQLHTRFRSLDRHQRGYLTPTDLLRIPQLSLNPLHRQ 65

  Fly    66 IVHSFFAESNDD-RVNFRQFMNVLAHFRPLRDNKQS--KLNSREEKLKFAFKMYDLDDDGVISRD 127
            |:..||...:.. |:.|:||::..:.....:..:.|  :.:.|.:||:...||:|....|.|:|.
  Fly    66 IIDGFFPSRDPSARIGFKQFVDTCSTILVPQFGRGSVRRRDGRVQKLQLLSKMFDTRRSGCITRS 130

  Fly   128 ELLSILHMMVG------------ANISQDQLVSI-AERTILEAD---LCCQGKISFEDFCKALDR 176
            :...|:..:|.            ..:|:::|..: ||..:||..   .||. .||:.:|.|.|..
  Fly   131 DFRQIMRSIVNLAWSQQQDQERQEGLSENRLPEVEAELQLLEHQAFGFCCD-HISYGEFEKRLFS 194

  Fly   177 TDVDQKMSI 185
            .|||:::||
  Fly   195 VDVDRRLSI 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 50/168 (30%)
CG32812NP_001284770.1 EF-hand_7 31..136 CDD:290234 35/104 (34%)
EF-hand_6 117..139 CDD:290141 7/21 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469399
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S676
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2564
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.800

Return to query results.
Submit another query.