Sequence 1: | NP_001262295.1 | Gene: | elm / 40695 | FlyBaseID: | FBgn0037358 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038462.1 | Gene: | KCNIP3 / 30818 | HGNCID: | 15523 | Length: | 256 | Species: | Homo sapiens |
Alignment Length: | 184 | Identity: | 48/184 - (26%) |
---|---|---|---|
Similarity: | 91/184 - (49%) | Gaps: | 34/184 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 EEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGT-LSREDLMRI------PELAINPLCERIVHS 69
Fly 70 FFAESNDDRVNFRQF---MNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLS 131
Fly 132 I---LHMMVGAN----ISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTD 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
elm | NP_001262295.1 | FRQ1 | 23..173 | CDD:227455 | 43/166 (26%) |
KCNIP3 | NP_038462.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..20 | ||
FRQ1 | 81..245 | CDD:227455 | 47/180 (26%) | ||
EFh | 130..192 | CDD:238008 | 22/74 (30%) | ||
EFh | 166..238 | CDD:238008 | 22/71 (31%) | ||
Interaction with KCND2. /evidence=ECO:0000250 | 243..256 | 0/1 (0%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.920 |