DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and KCNIP3

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_038462.1 Gene:KCNIP3 / 30818 HGNCID:15523 Length:256 Species:Homo sapiens


Alignment Length:184 Identity:48/184 - (26%)
Similarity:91/184 - (49%) Gaps:34/184 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGT-LSREDLMRI------PELAINPLCERIVHS 69
            |.:.|:|.:|.||..:::.||..|    :|:|.| |..||..::      |:.........:.::
Human    77 EGLDQLQAQTKFTKKELQSLYRGF----KNECPTGLVDEDTFKLIYAQFFPQGDATTYAHFLFNA 137

  Fly    70 FFAESNDDRVNFRQF---MNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLS 131
            |.|:.| ..::|..|   :::|     ||       .:..||||:||.:||::.||.|:::|:|:
Human   138 FDADGN-GAIHFEDFVVGLSIL-----LR-------GTVHEKLKWAFNLYDINKDGYITKEEMLA 189

  Fly   132 I---LHMMVGAN----ISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTD 178
            |   ::.|:|.:    :.:|......||...:.|....|.::.|:|.:|..:.:
Human   190 IMKSIYDMMGRHTYPILREDAPAEHVERFFEKMDRNQDGVVTIEEFLEACQKDE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 43/166 (26%)
KCNIP3NP_038462.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
FRQ1 81..245 CDD:227455 47/180 (26%)
EFh 130..192 CDD:238008 22/74 (30%)
EFh 166..238 CDD:238008 22/71 (31%)
Interaction with KCND2. /evidence=ECO:0000250 243..256 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.