DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Guca1a

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001100357.1 Gene:Guca1a / 301233 RGDID:1308712 Length:202 Species:Rattus norvegicus


Alignment Length:171 Identity:44/171 - (25%)
Similarity:80/171 - (46%) Gaps:21/171 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 EETGFTPNQIERLYSRFTSLDRNDC--GTLSREDLMRIPELA-INPLCERIVHSFFAESNDDRVN 80
            ||...|  :..:.|.:|.:    :|  |.|:..:..:...|. ::|...:.|...|...:.::..
  Rat    11 EELSST--ECHQWYKKFMT----ECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDG 69

  Fly    81 FRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQ 145
            :..||..:|....:...|.      |:||::.||:||:|.:|.|.|||||:|:..:...|...|.
  Rat    70 YIDFMEYVAALSLVLKGKV------EQKLRWYFKLYDVDGNGCIDRDELLTIIRAIRTINPWSDS 128

  Fly   146 LVSIAERT---ILEADLCCQGKISFEDFCKALDRTDVDQKM 183
            .:|..|.|   ..:.|:...|::|.|:|.:.:.:   ||.:
  Rat   129 SMSAEEFTDTVFAKIDINGDGELSLEEFMEGVQK---DQML 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 40/155 (26%)
Guca1aNP_001100357.1 FRQ1 12..163 CDD:227455 41/165 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.