DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Ppp3r1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_006251579.3 Gene:Ppp3r1 / 29748 RGDID:69230 Length:216 Species:Rattus norvegicus


Alignment Length:175 Identity:67/175 - (38%)
Similarity:106/175 - (60%) Gaps:9/175 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESN 75
            ||....::..:.|..::|:||..||..||.::.|:||.|:.|.:|||..|||.:|::..|..:.|
  Rat    49 NEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGN 113

  Fly    76 DDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGAN 140
            .: |:|::|:..::.|        |....:|:||:|||::||:|.||.||..||..:|.||||.|
  Rat   114 GE-VDFKEFIEGVSQF--------SVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNN 169

  Fly   141 ISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSI 185
            :...||..|.::||:.||....|:||||:||..:...|:.:||.:
  Rat   170 LKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 62/149 (42%)
Ppp3r1XP_006251579.3 PTZ00184 64..200 CDD:185504 59/144 (41%)
EFh 71..126 CDD:238008 21/55 (38%)
EFh 137..203 CDD:238008 34/65 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.