DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Tescl

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001099703.1 Gene:Tescl / 292706 RGDID:1311676 Length:232 Species:Rattus norvegicus


Alignment Length:205 Identity:66/205 - (32%)
Similarity:104/205 - (50%) Gaps:32/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 AQIQE----ETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESN 75
            |.|||    :..|:.:||::|:.||..|. .|..||..|:...:.:|..||:..|||.:||...|
  Rat    22 AHIQEAFMKKCDFSWDQIKQLHQRFRLLS-GDQPTLRPENFDNVLDLEFNPIRSRIVRAFFDNRN 85

  Fly    76 --------DDRVNFRQFMNVLAHFRPL--RDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELL 130
                    .:.:.|:.|:.::::||||  |.||:.....|:||::|.|.|||.|.||:|:..|..
  Rat    86 LGKGTSGLAEEITFQDFLTIISYFRPLEPRPNKEEAEQYRKEKMQFLFNMYDQDGDGIITLQEYR 150

  Fly   131 SILHMMVGANISQDQLV------SIAERTILEA----------DLCCQGKISFEDFCKALDRTDV 179
            .::..::.||...:...      |||...::||          |...:| |:||||.|.....::
  Rat   151 RVVEDLLSANPQAETATVRSVANSIARVALMEASRASDQPLNEDEPYEG-ITFEDFFKTWQSLEL 214

  Fly   180 DQKMSIRFLN 189
            :.||.:.|||
  Rat   215 EVKMQVSFLN 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 56/175 (32%)
TesclNP_001099703.1 PTZ00183 30..206 CDD:185503 55/177 (31%)
EFh 128..>165 CDD:298682 13/36 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350450
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.