DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and Tesc

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_006249488.1 Gene:Tesc / 288689 RGDID:1566317 Length:247 Species:Rattus norvegicus


Alignment Length:233 Identity:72/233 - (30%)
Similarity:118/233 - (50%) Gaps:55/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NEEIAQIQEETGFTPNQIERLYSRFTSLDRND-----CGT------------------------- 45
            :||:.:::.:|||:.:|||:|:.||..|..:.     |.:                         
  Rat     8 SEEVRELEGKTGFSSDQIEQLHRRFKQLSGDQPTIRLCSSRLCSVRSVSVPPTSQLPLSVKLQWR 72

  Fly    46 --LSREDLMRIPELAINPLCERIVHSFFAESN--------DDRVNFRQFMNVLAHFRPL---RDN 97
              .|:|:...:|:|.:||:..:||.:||...|        .|.:||..|:.::::|||:   ...
  Rat    73 PVCSKENFNNVPDLELNPIRSKIVRAFFDNRNLRKGSSGLADEINFEDFLTIMSYFRPIDTTLGE 137

  Fly    98 KQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGAN--ISQDQLVSIAERTILEADLC 160
            :|.:| ||:|||||.|.|||.|.||.|:.:|..:::..::..|  |.::...|||:..::||...
  Rat   138 EQVEL-SRKEKLKFLFHMYDSDSDGRITLEEYRNVVEELLSGNPHIEKESARSIADGAMMEAASV 201

  Fly   161 CQGK---------ISFEDFCKALDRTDVDQKMSIRFLN 189
            |.|:         |:||||.|.....|::.||.|||||
  Rat   202 CVGQMEPDQVYEGITFEDFLKIWQGIDIETKMHIRFLN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 59/203 (29%)
TescXP_006249488.1 EFh 147..>175 CDD:298682 13/27 (48%)
EF-hand_7 148..223 CDD:290234 26/74 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350447
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.