DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and ncs-4

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_509708.2 Gene:ncs-4 / 184757 WormBaseID:WBGene00008998 Length:224 Species:Caenorhabditis elegans


Alignment Length:186 Identity:43/186 - (23%)
Similarity:85/186 - (45%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMR------IPELAINPLCERIVH 68
            |...:.|:.:||.|:.|::..:|..|.....|   .:..:::||      .|...|....:.:..
 Worm    41 RPSSLQQVVDETHFSKNEVRAIYRAFKETSPN---AVINKNIMREKFAELFPHGDIEHYSDLLFE 102

  Fly    69 SFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKL--NSREEKLKFAFKMYDLDDDGVISRDELLS 131
            :|..:.| ..:||::|:..|           |.|  .:.:|||.:.:|:||..:.|.::.|.|..
 Worm   103 TFDNDGN-GTINFQEFVKAL-----------SILCRGTLDEKLDWLYKLYDPKEKGEVTWDRLFY 155

  Fly   132 ILHMM---VGANI----SQDQLVSIAERTILEADLCCQGKISFEDF---CKALDRT 177
            ::..|   :|.:.    :::|...:..:...:.|:..:|:|:.:||   ||. |||
 Worm   156 VITSMDDLMGKHARPHHTREQKCELTNQVFAKFDVGKKGRITKKDFLHICKT-DRT 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 35/167 (21%)
ncs-4NP_509708.2 FRQ1 41..211 CDD:227455 43/186 (23%)
EFh 101..149 CDD:238008 15/59 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.