DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and cnb-1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001256318.1 Gene:cnb-1 / 179572 WormBaseID:WBGene00000554 Length:171 Species:Caenorhabditis elegans


Alignment Length:163 Identity:66/163 - (40%)
Similarity:96/163 - (58%) Gaps:9/163 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCERIVHSFFAESNDDRVNFRQFM 85
            :.|...::.||..||..||.:..|:||.|:.|.:|||..|||.:|:: ..|.|..:..|:||:|:
 Worm    13 SNFDAYELRRLTRRFKKLDVDGSGSLSVEEFMSLPELQQNPLVQRVI-DIFDEDGNGEVDFREFI 76

  Fly    86 NVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIA 150
            ..::.|        |....:..||||||::||:|.||.||..||..:|.||||.|:...||..|.
 Worm    77 QGISQF--------SVKGDKNTKLKFAFRIYDMDRDGFISNGELFQVLKMMVGNNLKDSQLQQIV 133

  Fly   151 ERTILEADLCCQGKISFEDFCKALDRTDVDQKM 183
            ::|||..|....|||||::||..::.|:|.:||
 Worm   134 DKTILFHDKDGDGKISFQEFCDVVEHTEVHKKM 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 62/149 (42%)
cnb-1NP_001256318.1 FRQ1 13..161 CDD:227455 62/156 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.