DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and pbo-1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_497601.1 Gene:pbo-1 / 175385 WormBaseID:WBGene00003941 Length:196 Species:Caenorhabditis elegans


Alignment Length:196 Identity:86/196 - (43%)
Similarity:123/196 - (62%) Gaps:9/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGT-----LSREDLMRIPELAIN 60
            ||..||. :...|:..:..|:|.:...|.:||.||.||..:...|     |::.|...|.||..|
 Worm     1 MGQNSSQ-IPEHELEHLSIESGLSRGGILKLYGRFISLATHRDKTTNEYFLTKGDFQSIAELKQN 64

  Fly    61 PLCERIVHSFFAES---NDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDG 122
            ||.:||:.:|||::   ...:|.|:.|:.||:||||:..||....||||.||:|||.||||:..|
 Worm    65 PLGDRIIDAFFADAEVLERRKVYFKDFVKVLSHFRPINKNKPHPWNSREAKLRFAFTMYDLNKSG 129

  Fly   123 VISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRF 187
            .|::||...||.||:|..:.:||:.|||:||:.|||....|.|:|::||.|:::||::||||.||
 Worm   130 TITKDEFQDILAMMIGVGVPKDQVNSIADRTMREADRDGDGFITFQEFCNAMEKTDIEQKMSFRF 194

  Fly   188 L 188
            |
 Worm   195 L 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 69/157 (44%)
pbo-1NP_497601.1 EFh 115..181 CDD:238008 33/65 (51%)
EF-hand_7 116..181 CDD:290234 32/64 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I5465
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46002
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.890

Return to query results.
Submit another query.