DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and calm-1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_492514.2 Gene:calm-1 / 172774 WormBaseID:WBGene00009260 Length:201 Species:Caenorhabditis elegans


Alignment Length:199 Identity:59/199 - (29%)
Similarity:98/199 - (49%) Gaps:31/199 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSS------LFLR-----NEEIAQIQEETGFTPNQIERLYSRFTSL-----------DRNDC 43
            |||.:|      ||.:     .|::.:.|:.|.||...|.|||.||.:|           :|...
 Worm     1 MGNNASSLSELNLFSKGGVFTREQLDEYQDCTFFTRKDIIRLYKRFYALNPHKVPTNMQGNRPAI 65

  Fly    44 GTLSREDLMRIPELAINPLCERIVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEK 108
            .||:.|::.::|||..||...||. ..|:|.....::|..|:::.:.|        |::...:.|
 Worm    66 TTLTFEEVEKMPELKENPFKRRIC-EVFSEDGRGNLSFDDFLDMFSVF--------SEMAPLQLK 121

  Fly   109 LKFAFKMYDLDDDGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKA 173
            ||:||::||.|.|.::..|:|..::..:....:|..::..|.||.|.||||.....|:|.:|...
 Worm   122 LKYAFRIYDYDGDELLGHDDLSKMIRSLTRDELSDVEVEFIIERIIEEADLDGDSSINFAEFEHV 186

  Fly   174 LDRT 177
            :.|:
 Worm   187 VSRS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 49/160 (31%)
calm-1NP_492514.2 FRQ1 32..192 CDD:227455 51/168 (30%)
EFh 121..183 CDD:298682 22/61 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.