DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and guca1b

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_571946.1 Gene:guca1b / 140431 ZFINID:ZDB-GENE-011128-6 Length:197 Species:Danio rerio


Alignment Length:192 Identity:46/192 - (23%)
Similarity:78/192 - (40%) Gaps:51/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EIAQIQEETGFTPNQIERLYSRFTSLDRNDC--GTLSREDLMRIPELAINPLCERIVHSFFA--- 72
            ::|::||           .|.:|..    :|  |||...|......:..||.....:.:.|.   
Zfish    15 DVAELQE-----------WYKKFVI----ECPSGTLFMHDFKSFFGVTENPEAADYIENMFRAFD 64

  Fly    73 ESNDDRVNFRQF---MNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSIL- 133
            ::.|:.::|.::   :|::.         :.||   |.|||:.|||||.|..|.|.:.||..|: 
Zfish    65 KNGDNTIDFLEYVAALNLVL---------RGKL---EHKLKWTFKMYDKDGSGCIDKTELKEIVE 117

  Fly   134 ---------HMMVGAN---ISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKM 183
                     |..:.|.   ::.||:|   :|.....|....|::|.::|.....|.....||
Zfish   118 SIYRLKKACHGELDAECNLLTPDQVV---DRIFELVDENGDGELSLDEFIDGARRDKWVMKM 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 40/170 (24%)
guca1bNP_571946.1 FRQ1 1..171 CDD:227455 44/185 (24%)
EFh <29..77 CDD:298682 10/47 (21%)
EFh 55..116 CDD:238008 20/72 (28%)
EFh 91..168 CDD:238008 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.