DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CIB4

DIOPT Version :10

Sequence 1:NP_649568.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_011530816.1 Gene:CIB4 / 130106 HGNCID:33703 Length:201 Species:Homo sapiens


Alignment Length:181 Identity:44/181 - (24%)
Similarity:84/181 - (46%) Gaps:25/181 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 IQEETGFTPNQIERLYSRFTSLDRNDC--------GTLSREDLMRIPELAINPLCERIVHSFFAE 73
            :|..|..|.|:|..::..|..|    |        .||:.:.:..:|.|.:||..:||...|   
Human    33 LQALTFLTRNEILCIHDTFLKL----CPPGKYYKEATLTMDQVSSLPALRVNPFRDRICRVF--- 90

  Fly    74 SNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLS-ILHMMV 137
            |:....:|...:.:.:.|        |:......|:::||::||.:::|.|..::|.. ||.::.
Human    91 SHKGMFSFEDVLGMASVF--------SEQACPSLKIEYAFRIYDFNENGFIDEEDLQRIILRLLN 147

  Fly   138 GANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRT-DVDQKMSIRF 187
            ..::|:|.|:.:....:.|:||.....:||.:|..|:.:: |......|.|
Human   148 SDDMSEDLLMDLTNHVLSESDLDNDNMLSFSEFEHAMAKSPDFMNSFRIHF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_649568.1 FRQ1 27..174 CDD:444056 36/155 (23%)
CIB4XP_011530816.1 EF-hand_7 117..184 CDD:463900 19/66 (29%)

Return to query results.
Submit another query.