Sequence 1: | NP_001262295.1 | Gene: | elm / 40695 | FlyBaseID: | FBgn0037358 | Length: | 189 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_473454.1 | Gene: | CIB3 / 117286 | HGNCID: | 24580 | Length: | 187 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 55/198 - (27%) |
---|---|---|---|
Similarity: | 91/198 - (45%) | Gaps: | 35/198 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRF-------TSLDRNDCGTLS--REDLMRIPE 56
Fly 57 LAINPLCERIVHSFFAESNDDRV---NFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDL 118
Fly 119 DDDGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKM 183
Fly 184 SIR 186 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
elm | NP_001262295.1 | FRQ1 | 23..173 | CDD:227455 | 44/161 (27%) |
CIB3 | NP_473454.1 | FRQ1 | 20..178 | CDD:227455 | 48/178 (27%) |
EFh | 111..173 | CDD:238008 | 19/71 (27%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156542 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1271942at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.850 |