DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CIB3

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_473454.1 Gene:CIB3 / 117286 HGNCID:24580 Length:187 Species:Homo sapiens


Alignment Length:198 Identity:55/198 - (27%)
Similarity:91/198 - (45%) Gaps:35/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRF-------TSLDRNDCGTLS--REDLMRIPE 56
            ||||.::| .:|::...|:.|.||..:|.||:.|:       ..||...|..:.  .|.:..:||
Human     1 MGNKQTVF-THEQLEAYQDCTFFTRKEIMRLFYRYQDLAPQLVPLDYTTCPDVKVPYELIGSMPE 64

  Fly    57 LAINPLCERIVHSFFAESNDDRV---NFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDL 118
            |..||..:||. ..|:|..|..:   ||....:|::...|           |:.|..:|||:||.
Human    65 LKDNPFRQRIA-QVFSEDGDGHMTLDNFLDMFSVMSEMAP-----------RDLKAYYAFKIYDF 117

  Fly   119 DDDGVISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKM 183
            ::|..|...:|...:..:....:|.:::..:.|:.:.|||....|::|.|||          |.|
Human   118 NNDDYICAWDLEQTVTKLTRGGLSAEEVSLVCEKVLDEADGDHDGRLSLEDF----------QNM 172

  Fly   184 SIR 186
            .:|
Human   173 ILR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 44/161 (27%)
CIB3NP_473454.1 FRQ1 20..178 CDD:227455 48/178 (27%)
EFh 111..173 CDD:238008 19/71 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156542
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.