DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and CHP1

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_009167.1 Gene:CHP1 / 11261 HGNCID:17433 Length:195 Species:Homo sapiens


Alignment Length:196 Identity:119/196 - (60%)
Similarity:150/196 - (76%) Gaps:8/196 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNKSSLFLRNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDCGTLSREDLMRIPELAINPLCER 65
            ||:::|..||:||:.:|::||||:.:||.||||||||||:.:.|||||||..||||||||||.:|
Human     1 MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDR 65

  Fly    66 IVHSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSK-------LNSREEKLKFAFKMYDLDDDGV 123
            |:::||.| .:|:||||.||..||||||:.||::||       ||||..||.|||::||||.|..
Human    66 IINAFFPE-GEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEK 129

  Fly   124 ISRDELLSILHMMVGANISQDQLVSIAERTILEADLCCQGKISFEDFCKALDRTDVDQKMSIRFL 188
            |||||||.:|.||||.|||.:||.|||:|||.|||......|||.:|.|.|::.||:||||||||
Human   130 ISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSIRFL 194

  Fly   189 N 189
            :
Human   195 H 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 96/156 (62%)
CHP1NP_009167.1 FRQ1 1..182 CDD:227455 109/181 (60%)
Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6 1/3 (33%)
Nuclear export signal 1. /evidence=ECO:0000250 138..147 5/8 (63%)
Necessary for nuclear export signal 143..185 22/41 (54%)
Nuclear export signal 2. /evidence=ECO:0000250 176..185 3/8 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156546
Domainoid 1 1.000 131 1.000 Domainoid score I5167
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5235
Inparanoid 1 1.050 227 1.000 Inparanoid score I3486
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 1 1.000 - - otm42221
orthoMCL 1 0.900 - - OOG6_105864
Panther 1 1.100 - - LDO PTHR46002
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3958
SonicParanoid 1 1.000 - - X2469
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.