DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and guca1c

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_002940159.1 Gene:guca1c / 100497028 XenbaseID:XB-GENE-6039675 Length:188 Species:Xenopus tropicalis


Alignment Length:159 Identity:39/159 - (24%)
Similarity:74/159 - (46%) Gaps:20/159 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QIERLYSRFTSLDRNDC--GTLSREDLMRIPEL-AINPLCERIVHSFFAESNDDRVNFRQFMNVL 88
            ::.:.|.:|    ..:|  |.||..:...:..| .:|....|.:...|:..:.::..|..|:..:
 Frog    15 ELHKWYGKF----MKECPSGQLSLHEFKELLGLQGMNFEANRYIDQVFSTFDMNKDGFIDFLEFI 75

  Fly    89 AHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSILHMMVGAN----ISQDQLVSI 149
            |....:...|      .::|||:.||:||.|.:|.|.|.||||||..:...|    :|.::..|:
 Frog    76 AAINLVLRGK------IDQKLKWYFKLYDADGNGSIDRKELLSILTAVRAINGHRGMSPEEFTSM 134

  Fly   150 AERTILEADLCCQGKISFEDFCKALDRTD 178
            ....|   |:...|:::.|:|...:::.:
 Frog   135 VFEKI---DVNGDGELTLEEFINGIEKDE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 39/152 (26%)
guca1cXP_002940159.1 FRQ1 15..160 CDD:227455 39/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.