DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment elm and kcnip1a

DIOPT Version :9

Sequence 1:NP_001262295.1 Gene:elm / 40695 FlyBaseID:FBgn0037358 Length:189 Species:Drosophila melanogaster
Sequence 2:XP_021326489.1 Gene:kcnip1a / 100008068 ZFINID:ZDB-GENE-080721-17 Length:230 Species:Danio rerio


Alignment Length:139 Identity:34/139 - (24%)
Similarity:69/139 - (49%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RNEEIAQIQEETGFTPNQIERLYSRFTSLDRNDC--GTLSREDLMRI-----PELAINPLCERIV 67
            |.|.:.|::.:|.|...:::.||..|    :|:|  |.::.|...:|     |....:.....:.
Zfish    49 RPEGLEQLEAQTNFNKKELQVLYRGF----KNECPSGVVNEETFKQIYSQFFPHGDASTYAHYLF 109

  Fly    68 HSFFAESNDDRVNFRQFMNVLAHFRPLRDNKQSKLNSREEKLKFAFKMYDLDDDGVISRDELLSI 132
            :: |..|::..:.|..|:..|:..  ||       .:..|||::.|.:||::.||.|:::|::.|
Zfish   110 NA-FDSSHNGSIKFEDFVTALSIL--LR-------GTTTEKLEWTFNLYDINRDGYINKEEMMDI 164

  Fly   133 ---LHMMVG 138
               ::.|:|
Zfish   165 VKAIYDMMG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
elmNP_001262295.1 FRQ1 23..173 CDD:227455 30/126 (24%)
kcnip1aXP_021326489.1 FRQ1 53..219 CDD:227455 32/135 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.