DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CBR1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001748.1 Gene:CBR1 / 873 HGNCID:1548 Length:277 Species:Homo sapiens


Alignment Length:251 Identity:63/251 - (25%)
Similarity:95/251 - (37%) Gaps:58/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VVLITGAASGIGAAAAEMFSKL-GACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPEIE 78
            |.|:||...|||.|......:| ...:.|..|:.......:::....|..|.....|:.....|.
Human     7 VALVTGGNKGIGLAIVRDLCRLFSGDVVLTARDVTRGQAAVQQLQAEGLSPRFHQLDIDDLQSIR 71

  Fly    79 CIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTK----LLLPQLLQ 139
            .:.....:.| |.||||||.|||    ..:..:...|....|..:::.|:.|:    .||| |::
Human    72 ALRDFLRKEY-GGLDVLVNNAGI----AFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLP-LIK 130

  Fly   140 CKGSIVNVSSVCGLRAF----PNL-------------------------------------VAYN 163
            .:|.:|||||:..:||.    |.|                                     .||.
Human   131 PQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYG 195

  Fly   164 MSKAAVDQFTRSLALDLGPQ----GVRVNAVNPGVIRTNLQKAGGMDEQSYAEFLE 215
            ::|..|...:|..|..|..|    .:.:||..||.:||::  ||....:|..|..|
Human   196 VTKIGVTVLSRIHARKLSEQRKGDKILLNACCPGWVRTDM--AGPKATKSPEEGAE 249

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 63/251 (25%)
NADB_Rossmann 11..261 CDD:304358 63/251 (25%)
CBR1NP_001748.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 63/251 (25%)
Glutathione binding 95..97 0/1 (0%)