DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and SPS19

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_014197.2 Gene:SPS19 / 855518 SGDID:S000005146 Length:292 Species:Saccharomyces cerevisiae


Alignment Length:251 Identity:70/251 - (27%)
Similarity:117/251 - (46%) Gaps:9/251 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAG----DL 71
            |.|||..:||.|..|.....|....||...|:|.|::|......|...::..:...:..    |:
Yeast    22 FKGKVAFVTGGAGTICRVQTEALVLLGCKAAIVGRDQERTEQAAKGISQLAKDKDAVLAIANVDV 86

  Fly    72 LKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQ 136
            ....::|...:||.|:: ||:|.::.||.........:.....|..|::.::...|...|..|.:
Yeast    87 RNFEQVENAVKKTVEKF-GKIDFVIAGAAGNFVCDFANLSPNAFKSVVDIDLLGSFNTAKACLKE 150

  Fly   137 LLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQK 201
            |.:.||||:.||:.......|.......:||.:|...::||::|||.|:|.|.:.||.|    ..
Yeast   151 LKKSKGSILFVSATFHYYGVPFQGHVGAAKAGIDALAKNLAVELGPLGIRSNCIAPGAI----DN 211

  Fly   202 AGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
            ..|:...:..::.|.:.....|.|:|..:::|.:..::.|..||:|||..|.||||
Yeast   212 TEGLKRLAGKKYKEKALAKIPLQRLGSTRDIAESTVYIFSPAASYVTGTVLVVDGG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 68/249 (27%)
NADB_Rossmann 11..261 CDD:304358 70/251 (28%)
SPS19NP_014197.2 TER_DECR_SDR_a 22..270 CDD:187627 70/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.