DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and CBR4

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_006714454.1 Gene:CBR4 / 84869 HGNCID:25891 Length:247 Species:Homo sapiens


Alignment Length:269 Identity:82/269 - (30%)
Similarity:126/269 - (46%) Gaps:46/269 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPEIE 78
            ||..:.|.:.|||.|.|::.::.|..||::.|..||   .......:|.:....:.|:.|..:::
Human     3 KVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEG---AKAAAGDLGGDHLAFSCDVAKEHDVQ 64

  Fly    79 CIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQCK-- 141
            ....: .|::.|:::.|||.|||...|.|..|:.......:..|          ||..:|.||  
Human    65 NTFEE-LEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVSQLHTN----------LLGSMLTCKAA 118

  Fly   142 ---------GSIVNVS----------SVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRV 187
                     ||||||.          |:.||:.......|:.||..:..|:|:||.::..:.:||
Human   119 MRTMIQQQGGSIVNVGHRREMLLHKRSIVGLKGNSGQSVYSASKGGLVGFSRALAKEVARKKIRV 183

  Fly   188 NAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTL 252
            |.|.||.:.|::.|  .:.|       ||.||...|||.||..|||.|:.||..  :.::||..|
Human   184 NVVAPGFVHTDMTK--DLKE-------EHLKKNIPLGRFGETIEVAHAVVFLLE--SPYITGHVL 237

  Fly   253 PVDGGKQVM 261
            .||||.|::
Human   238 VVDGGLQLI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 79/263 (30%)
NADB_Rossmann 11..261 CDD:304358 82/267 (31%)
CBR4XP_006714454.1 NADB_Rossmann 3..243 CDD:304358 80/264 (30%)
3oxo_ACP_reduc 7..243 CDD:273824 78/260 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.