Sequence 1: | NP_730973.1 | Gene: | CG31546 / 40691 | FlyBaseID: | FBgn0051546 | Length: | 264 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_115679.2 | Gene: | HSDL2 / 84263 | HGNCID: | 18572 | Length: | 418 | Species: | Homo sapiens |
Alignment Length: | 291 | Identity: | 67/291 - (23%) |
---|---|---|---|
Similarity: | 106/291 - (36%) | Gaps: | 74/291 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAG------- 69
Fly 70 DLLKPPEIECIARKTTERYEGKLDVLVNGA-GIMPTGTLQSTELACFTHVMEANVRSGFYLTKLL 133
Fly 134 LPQLLQCK-GSIVNVSSVCGLRA--FPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAV----- 190
Fly 191 ----------NPG-----------------------------VIRTNLQKAGGMDE-QSYA---- 211
Fly 212 ------EFLEH-----SKKTHALGRIGEPKE 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31546 | NP_730973.1 | fabG | 9..257 | CDD:235975 | 67/291 (23%) |
NADB_Rossmann | 11..261 | CDD:304358 | 67/291 (23%) | ||
HSDL2 | NP_115679.2 | HSDL2_SDR_c | 8..248 | CDD:187663 | 53/241 (22%) |
SCP2 | 319..412 | CDD:376720 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0725 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |