DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT1G62610

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001185294.1 Gene:AT1G62610 / 842558 AraportID:AT1G62610 Length:282 Species:Arabidopsis thaliana


Alignment Length:260 Identity:71/260 - (27%)
Similarity:126/260 - (48%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLK- 73
            :...||||:|||:||||........|.|..:....|..:.|..:.......|  ..|:....|: 
plant    18 ELKDKVVLVTGASSGIGREICLDLCKAGCKIVAAARRVDRLNSLCSEINSFG--AIGVQAAALEL 80

  Fly    74 --PPEIECIARKTTERYE--GKLDVLVNGAGIMPTGTLQST-ELAC--FTHVMEANVRSGFYLTK 131
              ..:.:.|.:...|.:|  |.:|||:|.|||  .|.::|: :|:.  :..|...|:...:.::|
plant    81 DVSSDADTIRKAVKEAWEIFGTIDVLINNAGI--RGNVKSSLDLSKEEWDKVFRTNLTGSWLISK 143

  Fly   132 LLLPQLLQCK--GSIVNVSSVCGLR--AFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNP 192
            .:...:...|  ||::||||:.||.  .....:||..||..||..||.:|::|....:|||::.|
plant   144 YVCLLMRDAKRGGSVINVSSISGLHRGLLRGGLAYACSKGGVDTMTRMMAIELAVYKIRVNSIAP 208

  Fly   193 GVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
            |:.|:.:.:  |:.::.:.|.:........:.:..:| .:.:.:.:|..:.:.:|||.|..||.|
plant   209 GIFRSEITQ--GLFQKEWLEKVTEKIVPLKMQQTVDP-GLTSLVRYLIHDSSQYVTGNTYIVDSG 270

  Fly   258  257
            plant   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 70/258 (27%)
NADB_Rossmann 11..261 CDD:304358 71/259 (27%)
AT1G62610NP_001185294.1 fabG 19..273 CDD:235546 71/259 (27%)
SDR_c 24..268 CDD:212491 66/250 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.