DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT5G18210

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_197322.2 Gene:AT5G18210 / 831939 AraportID:AT5G18210 Length:277 Species:Arabidopsis thaliana


Alignment Length:240 Identity:69/240 - (28%)
Similarity:116/240 - (48%) Gaps:14/240 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLAL--VDREEEGLICVMKRCMKMGHEPYGIA----GD 70
            :|:|.::||::.|||.|.|...::|||.:.:  ..|..|......:.....|..|..||    .|
plant     9 AGRVAIVTGSSRGIGRAIAIHLAELGAKIVINYTTRSTEADQVAAEINSSAGTVPQPIAVVFLAD 73

  Fly    71 LLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTG--TLQSTELACFTHVMEANVRSGFYLTKLL 133
            :.:|.:|:.:.....:.:...:.:|||.|||:...  |:.:|.:..|..:.:.|.|..|...|..
plant    74 ISEPSQIKSLFDAAEKAFNSPVHILVNSAGILNPNYPTIANTPIEEFDRIFKVNTRGSFLCCKEA 138

  Fly   134 LPQLLQCKGS-IVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRT 197
            ..:|.:..|. |:.::|.......|...||..|||||:...:.||.:|...|:..|.|:||.:.|
plant   139 AKRLKRGGGGRIILLTSSLTEALIPGQGAYTASKAAVEAMVKILAKELKGLGITANCVSPGPVAT 203

  Fly   198 NLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASE 242
            .: ...|..|::....:|.|    ..||:||.|::|:.:.||||:
plant   204 EM-FFDGKSEETVMNIIERS----PFGRLGETKDIASVVGFLASD 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 69/240 (29%)
NADB_Rossmann 11..261 CDD:304358 69/240 (29%)
AT5G18210NP_197322.2 fabG 7..245 CDD:235500 69/240 (29%)
NADB_Rossmann 8..245 CDD:304358 69/240 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.