DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT3G55310

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_191091.2 Gene:AT3G55310 / 824697 AraportID:AT3G55310 Length:279 Species:Arabidopsis thaliana


Alignment Length:266 Identity:73/266 - (27%)
Similarity:135/266 - (50%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFSGKVVLITGAASGIGAAAAEMFSKLG----ACLALVDREEEGLICVMKRCMKM-GHEPYGIAG 69
            :...||||:|||:||||.......:|.|    |....|||       :...|.:: .....||..
plant    16 ELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDR-------LNSLCSEINSFSSTGIQA 73

  Fly    70 DLLK---PPEIECIARKTTERYE--GKLDVLVNGAGIMPTGTLQSTELA--CFTHVMEANVRSGF 127
            ..|:   ..:...|.:...|.::  ||:|.|:|.|||.....| |.:|:  .:.:|...|::..:
plant    74 AALELDVSSDAATIQKAVREAWDIFGKIDALINNAGIRGNVKL-SLDLSEDEWDNVFNTNLKGPW 137

  Fly   128 YLTKLLLPQLLQCK--GSIVNVSSVCGLRAF-PNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNA 189
            .:.|.:...:...|  ||::|:|||.|:|:. |..:||:.||..||..:|.:|::||...:|||:
plant   138 LVAKYVCVLMRDAKRGGSVINISSVAGVRSIVPGGLAYSCSKGGVDTMSRMMAIELGVHKIRVNS 202

  Fly   190 VNPGVIRTNLQKAGGMDEQSYAEFLEH-SKKTHALGRIGEPKE--VAAAICFLASELASFVTGVT 251
            :.||:.::.:.:|     ....|:|:: :::|..| ::.:..:  :.:.:.:|..:.:.:::|.|
plant   203 IAPGLFKSEITQA-----LMQKEWLKNVTERTVPL-KVQQTIDPGLTSLVRYLIHDSSQYISGNT 261

  Fly   252 LPVDGG 257
            ..||.|
plant   262 YIVDSG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 72/264 (27%)
NADB_Rossmann 11..261 CDD:304358 73/265 (28%)
AT3G55310NP_191091.2 SDR_c 22..265 CDD:212491 68/256 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.