DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT3G55290

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_567019.1 Gene:AT3G55290 / 824695 AraportID:AT3G55290 Length:280 Species:Arabidopsis thaliana


Alignment Length:267 Identity:73/267 - (27%)
Similarity:141/267 - (52%) Gaps:34/267 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFSGKVVLITGAASGIGAAAAEMFSKLG----ACLALVDREEEGLICVMKRCMKM-GHEPYGIAG 69
            :...||||:|||:||||.......:|.|    |....|||       :...|.:: .....||..
plant    17 ELKDKVVLVTGASSGIGREICLDLAKAGCQVIAAARRVDR-------LNSLCSEINSFSSTGIQA 74

  Fly    70 DLLK---PPEIECIARKTTERYE--GKLDVLVNGAGIMPTGTLQST-ELA--CFTHVMEANVRSG 126
            ..|:   ..:...|.:...|.::  ||:|.|:|.|||  .|.::|: :|:  .:.:|.:.|::..
plant    75 AALELDVSSDAATIQKAVREAWDIFGKIDALINNAGI--RGNVKSSLDLSEDEWDNVFKTNLKGP 137

  Fly   127 FYLTKLLLPQLLQCK--GSIVNVSSVCGLRA-FPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVN 188
            :.::|.:...:...|  ||::|:||:.|:|. .|..:||..||..||..:|.:||:||...:|||
plant   138 WLVSKHVCMLMRDAKRGGSVINISSIAGIRGMLPGGLAYACSKGGVDTMSRMMALELGVHKIRVN 202

  Fly   189 AVNPGVIRTNLQKAGGMDEQSYAEFLEH-SKKTHALGRIGEPKE--VAAAICFLASELASFVTGV 250
            ::.||:.::.:.:  |:.::   |:|:: :::|..| ::.:..:  :.:.:.:|..:.:.:::|.
plant   203 SIAPGLFKSEITQ--GLMQK---EWLKNVTERTVPL-KVQQTVDPGLTSLVRYLIHDSSQYISGN 261

  Fly   251 TLPVDGG 257
            |..||.|
plant   262 TYIVDSG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 72/265 (27%)
NADB_Rossmann 11..261 CDD:304358 73/266 (27%)
AT3G55290NP_567019.1 fabG 18..271 CDD:235546 73/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.