DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT3G46170

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_190203.1 Gene:AT3G46170 / 823760 AraportID:AT3G46170 Length:288 Species:Arabidopsis thaliana


Alignment Length:261 Identity:70/261 - (26%)
Similarity:132/261 - (50%) Gaps:22/261 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKM-GHEPYGIAGDLLK 73
            :...||||:|||:||||........|.|..:..|.|..:.|..:   |.:: .....||....||
plant    25 ELKDKVVLVTGASSGIGREICLDLGKAGCKIIAVARRVDRLNSL---CSEINSSSSTGIQAAALK 86

  Fly    74 ------PPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQST-ELAC--FTHVMEANVRSGFYL 129
                  ...|:.:.:.....: ||:|.|:|.|||  .|.::|: :|:.  :.:|.:.|:...:.:
plant    87 LDVTSDAATIQKVVQGAWGIF-GKIDALINNAGI--RGNVKSSLDLSKEEWDNVFKTNLTGPWLV 148

  Fly   130 TKLLLPQLLQCK--GSIVNVSSVCGLRA-FPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVN 191
            :|.:...:...|  ||::|:||:.|:|. .|..:||..||..||..::.:|::||...:|||::.
plant   149 SKYVCVLMRDAKLGGSVINISSIAGIRGILPGALAYACSKIGVDTMSKMMAVELGVHKIRVNSIA 213

  Fly   192 PGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDG 256
            ||:.::.:.: |.|.::.:....|.:... .|.:..:| .:.:.:.:|..:.:.:::|.|..||.
plant   214 PGIFKSEITQ-GLMQKEWFKNVTERTVPL-KLQQTVDP-GITSLVRYLIHDSSQYISGNTYIVDS 275

  Fly   257 G 257
            |
plant   276 G 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 69/259 (27%)
NADB_Rossmann 11..261 CDD:304358 70/260 (27%)
AT3G46170NP_190203.1 SDR_c 31..274 CDD:212491 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.