DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT3G26760

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_189311.2 Gene:AT3G26760 / 822289 AraportID:AT3G26760 Length:300 Species:Arabidopsis thaliana


Alignment Length:271 Identity:91/271 - (33%)
Similarity:130/271 - (47%) Gaps:46/271 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGH---EPYGIAGDLLK- 73
            |||.:|||.|||||.|.||.|...||.:.:||.:||.           ||   ...|.|...|: 
plant    38 GKVAVITGGASGIGKATAEEFVSQGAQVIIVDIDEEA-----------GHMVATELGSAAHFLRC 91

  Fly    74 -PPEIECIAR--KTTERYEGKLDVLVNGAGI---MPTGTLQSTELACFTHVMEANVRSGF----Y 128
             ..|.|.||:  :|.....|||||::|.|||   :...::...::..:..||..|||...    :
plant    92 DVTEEEQIAKAVETAVTRHGKLDVMLNSAGISCSISPPSIADLDMDTYDKVMRLNVRGTVLGIKH 156

  Fly   129 LTKLLLPQLLQCKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPG 193
            ..:.::|   ...|||:.:||:.||.......||::||..:....:::|.:|...|:|:|.::|.
plant   157 AARAMIP---AGSGSILCLSSISGLMGGLGPHAYSISKFTIPGVVKTVASELCKHGLRINCISPA 218

  Fly   194 VIRTNLQKAGGMDEQSYAE-FLEHSKKTHALGRI----GEPK-------EVAAAICFLASELASF 246
            .|.|.|..      :.:.| |..||.:...|..|    ||.|       :||.|..:|||:.|.|
plant   219 GIPTPLTL------RMFREAFAGHSIREEQLLAIVNATGELKGEKCEEIDVAKAALYLASDDAKF 277

  Fly   247 VTGVTLPVDGG 257
            |||..|.||||
plant   278 VTGHNLVVDGG 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 89/269 (33%)
NADB_Rossmann 11..261 CDD:304358 91/271 (34%)
AT3G26760NP_189311.2 PLN02253 30..291 CDD:177895 91/271 (34%)
NADB_Rossmann 35..290 CDD:304358 91/271 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.