DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT3G03980

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_187048.1 Gene:AT3G03980 / 819553 AraportID:AT3G03980 Length:270 Species:Arabidopsis thaliana


Alignment Length:262 Identity:73/262 - (27%)
Similarity:118/262 - (45%) Gaps:18/262 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LDFSGKVVLITGAASGIGAAAAEMFSKLGACLAL------VDRE----EEGLICVMKRCMKMGHE 63
            |..:|:|.::||::.|||.|.|...::|||.:.:      .|.|    |.....|.:.....|..
plant    12 LPLAGRVAIVTGSSRGIGRAIAIHLAELGARIVINYTSKAADAERVASEINDFPVREEITGKGPR 76

  Fly    64 PYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPT--GTLQSTELACFTHVMEANVRSG 126
            ...:..::.:|.:::.:.......:|..:.:|||.|||:..  .|:..|.:..|.|....|.:..
plant    77 AIVVQANVSEPSQVKSMFDAAESAFEAPVHILVNSAGILDPKYPTIADTSVEDFDHTFSVNTKGA 141

  Fly   127 FYLTKLLLPQLLQCKGSIVNVSSVCGLRAF-PNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAV 190
            |..:|....:|.|..|..:.:.:....|:. |...||..|||||:...:.||.:|...|:..|.|
plant   142 FLCSKEAANRLKQGGGGRIILLTSSQTRSLKPGFGAYAASKAAVETMVKILAKELKGTGITANCV 206

  Fly   191 NPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVD 255
            .||.|.|.:...|     ...|.:|........||:||.|:|...:.|||.:...:|.|..:||:
plant   207 APGPIATEMFFDG-----KTPELVEKIAAESPFGRVGEAKDVVPLVGFLAGDGGEWVNGQIIPVN 266

  Fly   256 GG 257
            ||
plant   267 GG 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 71/260 (27%)
NADB_Rossmann 11..261 CDD:304358 72/260 (28%)
AT3G03980NP_187048.1 THN_reductase-like_SDR_c 14..270 CDD:187620 72/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.