DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT2G47150

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_182237.1 Gene:AT2G47150 / 819328 AraportID:AT2G47150 Length:200 Species:Arabidopsis thaliana


Alignment Length:261 Identity:66/261 - (25%)
Similarity:106/261 - (40%) Gaps:74/261 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPEI 77
            ||:|:|||.|||.||.:|.:|:..||.:.:||.:||                             
plant     3 GKIVIITGGASGTGAESARLFTDHGAQVVVVDLQEE----------------------------- 38

  Fly    78 ECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTEL-ACFTHVMEANVRSGFYLTKLLLPQLLQCK 141
                       :||            |...||.:. ..||.||        ..|:...|.:|:..
plant    39 -----------QGK------------TSPFQSAKTEQVFTVVM--------LQTRRNQPGVLETP 72

  Fly   142 GSIVNVSSVCGLRAFPNLVAYNMSKAAVD-QFTRSLALDLGPQG-------VRVNAVNPGVIRTN 198
            |||::::    |..|...:|.|:..|||. :......::.|.:|       |....|...::.|.
plant    73 GSILDLN----LERFHRTMAVNVRGAAVSIKHAARAMVEKGTRGSIVCTTSVTSEIVVRDLMNTR 133

  Fly   199 LQKAGGMDEQSYAEFLEHSKKTHAL-GRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQVMC 262
            .:..|..||::..:..|:.:..... |.:.:.:.||.|..||||:.:.:::|..|.||||..|:.
plant   134 RRSMGSHDEETAKQTEEYCEARGIFKGVVLKARHVAEAALFLASDDSVYISGQNLAVDGGFCVVK 198

  Fly   263 P 263
            |
plant   199 P 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 62/253 (25%)
NADB_Rossmann 11..261 CDD:304358 64/257 (25%)
AT2G47150NP_182237.1 NADB_Rossmann 1..194 CDD:304358 63/254 (25%)
PLN02253 1..194 CDD:177895 63/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.820

Return to query results.
Submit another query.