DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and SDR3

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_182235.1 Gene:SDR3 / 819326 AraportID:AT2G47130 Length:257 Species:Arabidopsis thaliana


Alignment Length:271 Identity:93/271 - (34%)
Similarity:131/271 - (48%) Gaps:30/271 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AGLDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEE----GLICVMK------RCMKMG 61
            :||...||:.:|||.||||||.|..:|:..||.:.:||.:||    ..:.|.|      ||    
plant     2 SGLRLDGKIAIITGGASGIGAEAVRLFTDHGAKVVIVDFQEELGQNVAVSVGKDKASFYRC---- 62

  Fly    62 HEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGIM-PTGTLQSTELACFTHVMEANVRS 125
                    |:....|:|...:.|.|:| ||||||.:.||:| ..|:.....|..|...|..|||.
plant    63 --------DVTNEKEVENAVKFTVEKY-GKLDVLFSNAGVMEQPGSFLDLNLEQFDRTMAVNVRG 118

  Fly   126 GFYLTKLLLPQLLQ--CKGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVN 188
            .....|.....:::  .:||||..:||......|...||..||.|:....:|....||..|:|||
plant   119 AAAFIKHAARAMVEKGTRGSIVCTTSVASEIGGPGPHAYTASKHALLGLVKSACGGLGKYGIRVN 183

  Fly   189 AVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHAL-GRIGEPKEVAAAICFLASELASFVTGVTL 252
            .|.|..:.|.:   ...||::.....|:|..|..| |.:.:.:.||.|..||||:.:::|:|..|
plant   184 GVAPYAVATAI---NSRDEETVRMVEEYSAATGILKGVVLKARHVAEAALFLASDDSAYVSGQNL 245

  Fly   253 PVDGGKQVMCP 263
            .||||..|:.|
plant   246 AVDGGYSVVKP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 88/261 (34%)
NADB_Rossmann 11..261 CDD:304358 89/263 (34%)
SDR3NP_182235.1 PLN02253 1..254 CDD:177895 91/267 (34%)
NADB_Rossmann 5..252 CDD:304358 89/262 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 118 1.000 Domainoid score I1923
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I1924
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - otm3543
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X68
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.