DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT2G30670

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_180625.1 Gene:AT2G30670 / 817617 AraportID:AT2G30670 Length:262 Species:Arabidopsis thaliana


Alignment Length:250 Identity:82/250 - (32%)
Similarity:134/250 - (53%) Gaps:7/250 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPEI 77
            |...|:||.|||||.|..|..:.|||.:.:.|..|..|...:....|.|.:..|...|:....|.
plant     9 GMTALVTGGASGIGHAIVEELAGLGARIYVCDISETLLNQSLSEWEKKGFQVSGSICDVSSHSER 73

  Fly    78 ECIARKTTERYEGKLDVLVNGAGIM-PTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQCK 141
            |.:.:..::.::|||::|||..|:: |..|::.. .|.|:..:..|:.|.::|::|..|.|...:
plant    74 ETLMQTVSKMFDGKLNILVNNVGVVNPKPTIEYV-AADFSFSISTNLESAYHLSQLSHPLLKASE 137

  Fly   142 -GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAGGM 205
             |||:.:|||.|:.:......|:::|.|::|..::||.:....|:|.|:|.|..|.|.:.:....
plant   138 FGSIIFISSVGGVVSMECGSIYSLTKGALNQLAKTLACEWARDGIRANSVAPNFIYTAMAQPFFK 202

  Fly   206 DEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQV 260
            |    |::.:.......|||.|||.||::.:.||....||::||.|:.||||..|
plant   203 D----ADYEKSLVSRTPLGRAGEPNEVSSLVAFLCLPAASYITGQTICVDGGLTV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 79/245 (32%)
NADB_Rossmann 11..261 CDD:304358 81/249 (33%)
AT2G30670NP_180625.1 PRK09242 1..256 CDD:181721 81/249 (33%)
NADB_Rossmann 4..254 CDD:304358 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.