DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT2G29370

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_850132.2 Gene:AT2G29370 / 817486 AraportID:AT2G29370 Length:268 Species:Arabidopsis thaliana


Alignment Length:269 Identity:82/269 - (30%)
Similarity:129/269 - (47%) Gaps:22/269 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKGKAGLD-----FSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKM 60
            |..:|::..|     ..|...|:||.:.|:|.|..|..:.|||.:....|:|..|...::.....
plant     1 MAKRGESLRDKPKWSLEGMTALVTGGSKGLGKAVVEELAMLGARVHTCARDETQLQESLREWQAK 65

  Fly    61 GHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQ-STELAC--FTHVMEAN 122
            |.:......|:....:.|.:....:..::|||.:||...||   |.|: :||...  |:.::..|
plant    66 GLQVTTSVCDVSSRDQREKLMETVSSLFQGKLSILVPNVGI---GVLKPTTECTAEEFSFIIATN 127

  Fly   123 VRSGFYLTKLLLPQLLQCKGS--IVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGV 185
            :.|.|:.::|..| ||:..||  ||.:|||.|:....|...|..:|.|::|..|:||.:.....:
plant   128 LESTFHFSQLAHP-LLKASGSGNIVLMSSVAGVVNLGNTSIYGATKGAMNQLARNLACEWASDNI 191

  Fly   186 RVNAVNPGVIRTNLQK--AGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVT 248
            |.|:|.|..|.|...|  .|..|.:      |..:....|.|:||..||::.:.||....||::|
plant   192 RANSVCPWFITTPSTKDFLGDKDVK------EKVESVTPLRRVGEANEVSSLVAFLCLPAASYIT 250

  Fly   249 GVTLPVDGG 257
            |.|:.||||
plant   251 GQTICVDGG 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 78/259 (30%)
NADB_Rossmann 11..261 CDD:304358 79/254 (31%)
AT2G29370NP_850132.2 NADB_Rossmann 13..263 CDD:389744 79/257 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.