DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and SAG13

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_180496.1 Gene:SAG13 / 817484 AraportID:AT2G29350 Length:269 Species:Arabidopsis thaliana


Alignment Length:271 Identity:87/271 - (32%)
Similarity:128/271 - (47%) Gaps:22/271 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGSKGKAG----LDFSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMG 61
            |..:|..|    ....|...|:||.:.|||.|..|..:.|||.:....|:|..|...::.....|
plant     1 MAKEGGLGENSRWSLGGMTALVTGGSKGIGEAVVEELAMLGAKVHTCARDETQLQERLREWQAKG 65

  Fly    62 HEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAG---IMPTGTLQSTELAC--FTHVMEA 121
            .:......|:....:...:....:..|:|||::|||..|   ..||     ||...  |:.||..
plant    66 FQVTTSVCDVSSRDQRVKLMETVSSLYQGKLNILVNNVGTSIFKPT-----TEYTAEDFSFVMAT 125

  Fly   122 NVRSGFYLTKLLLPQLLQC--KGSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQG 184
            |:.|.|:|::|..| ||:.  .||||.:||..|:........|..:|.|::|..|:||.:.....
plant   126 NLESAFHLSQLAHP-LLKASGSGSIVLISSAAGVVHVNVGSIYGATKGAMNQLARNLACEWASDN 189

  Fly   185 VRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTG 249
            :|.|:|.|..|.|.|.. ...||    ||.:.:.:|..:||:||..||:..:.||....||::||
plant   190 IRTNSVCPWYITTPLSN-DFFDE----EFKKEAVRTTPMGRVGEANEVSPLVAFLCLPSASYITG 249

  Fly   250 VTLPVDGGKQV 260
            .|:.||||..|
plant   250 QTICVDGGATV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 81/254 (32%)
NADB_Rossmann 11..261 CDD:304358 84/257 (33%)
SAG13NP_180496.1 NADB_Rossmann 12..261 CDD:419666 84/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.