DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT2G29340

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_565680.2 Gene:AT2G29340 / 817483 AraportID:AT2G29340 Length:307 Species:Arabidopsis thaliana


Alignment Length:254 Identity:89/254 - (35%)
Similarity:135/254 - (53%) Gaps:15/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPYGIAGDLLKPPEI 77
            |...|:||.|||||.|..|..:..||.:.:.|..|..|...:....|.|.:..|...|:...||.
plant     9 GMTALVTGGASGIGYAIVEELAGFGARIHVCDISEAKLNQSLSEWEKKGFQVSGSVCDVASRPER 73

  Fly    78 ECIARKTTERYEGKLDVLVNGAGIMPT-GTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQCK 141
            |.:.:..:.:::|||::||:..|::.: .|.:.||.....|: .:||.:.::.::|..| ||:..
plant    74 EELMQTVSSQFDGKLNILVSNVGVIRSKPTTEYTEDDFAFHI-SSNVEAAYHFSQLSHP-LLKAS 136

  Fly   142 --GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRTNLQKAGG 204
              |||:.|||:.|:.:|.....|.::|.|:.|..::||.:....|:|.|||.|.||.|.|     
plant   137 GYGSIIFVSSIAGVISFDAGSIYGLTKGALIQLAKNLACEWAKDGIRANAVAPNVINTPL----- 196

  Fly   205 MDEQSYAEFLEHSK---KTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQV 260
              .|||.|.:...|   ....|||:|||.|||:.:.||....||::||.|:.||||..|
plant   197 --SQSYLEDVSFKKALLSRTPLGRVGEPNEVASLVAFLCLPAASYITGQTICVDGGLTV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 86/249 (35%)
NADB_Rossmann 11..261 CDD:304358 89/254 (35%)
AT2G29340NP_565680.2 PRK09242 1..256 CDD:181721 89/254 (35%)
NADB_Rossmann 4..254 CDD:304358 89/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 1 1.000 - - mtm990
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.