DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and AT2G17845

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_565425.1 Gene:AT2G17845 / 816294 AraportID:AT2G17845 Length:312 Species:Arabidopsis thaliana


Alignment Length:272 Identity:74/272 - (27%)
Similarity:134/272 - (49%) Gaps:33/272 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DFSGKVVLITGAASGIGAAAAEMFSKLG----ACLALVDREEEGLICVMKRCMKMGHEPY--GIA 68
            :...||||:|||:||||.......:|.|    |....|||       :...|.::....|  ||.
plant    46 ELKDKVVLVTGASSGIGREVCLDLAKAGCKIIAAARRVDR-------LKSLCSEINRFEYSAGIQ 103

  Fly    69 GDLLK------PPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQST-ELA--CFTHVMEANVR 124
            .:.|:      ...::...:|..|.: ||:|.|:|.||.  .|.::|: :|:  .:..|.:.|:.
plant   104 AEALELDVSSDAATVQKAVKKAWEIF-GKIDALINNAGF--RGNVKSSLDLSEDEWDKVFKTNLT 165

  Fly   125 SGFYLTK---LLLPQLLQCKGSIVNVSSVCGLR--AFPNLVAYNMSKAAVDQFTRSLALDLGPQG 184
            ..:.::|   :|:....:..||::|:|||..|.  ..|..|||..||..||..||.:||:||...
plant   166 GTWLVSKYVCILMRDAKRGGGSVINISSVSWLHRGQVPGGVAYACSKGGVDTMTRMMALELGVYK 230

  Fly   185 VRVNAVNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTG 249
            :|||::.||::::.:.: |.|.::.....:|.:........: :| .:.:.:.:|..:.:.:::|
plant   231 IRVNSIAPGLLKSEITQ-GLMQKEWLKTVIERTVPLKVQQTV-DP-GLTSLLRYLVHDSSKYISG 292

  Fly   250 VTLPVDGGKQVM 261
            .|..||.|..::
plant   293 NTYIVDAGASLV 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 73/266 (27%)
NADB_Rossmann 11..261 CDD:304358 74/269 (28%)
AT2G17845NP_565425.1 fabG 47..303 CDD:235546 74/268 (28%)
SDR_c 52..298 CDD:212491 69/258 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1153
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.