DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and MOD1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_565331.1 Gene:MOD1 / 815152 AraportID:AT2G05990 Length:390 Species:Arabidopsis thaliana


Alignment Length:309 Identity:73/309 - (23%)
Similarity:122/309 - (39%) Gaps:66/309 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SKGKAGL--DFSGKVVLITGAA--SGIGAAAAEMFSKLGACLAL------------------VDR 45
            :|..:||  |..||...|.|.|  :|.|.|.|:..:..||.:.:                  .|:
plant    82 NKAPSGLPIDLRGKRAFIAGIADDNGYGWAIAKSLAAAGAEILVGTWVPALNIFETSLRRGKFDQ 146

  Fly    46 EE---EGLICVMKRCMKMG---HEPYGIAGDLLKPPEIECIARKTTERYE--------------- 89
            ..   :|.:..:|:...:.   ..|..:..|:           ||.:||.               
plant   147 SRVLPDGSLMEIKKVYALDAVFDNPEDVPEDV-----------KTNKRYAGSSNWTVQEAAECVK 200

  Fly    90 ---GKLDVLVNGAGIMP--TGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLLQCKGSIVNVSS 149
               |.:|:||:.....|  :..|..|....:...:.|:..|...|.:..|| ::...|:.::::.
plant   201 KDFGSIDILVHSLANGPEVSKPLLETSRKGYLAAISASSYSFVSLLRHFLP-IMNPGGASISLTY 264

  Fly   150 VCGLRAFPNL-VAYNMSKAAVDQFTRSLALDLG-PQGVRVNAVNPGVIRTNLQKAGGMDEQSYAE 212
            :...|..|.. ...:.:|||::..||.||.:.| ...:|||.::.|.:.:...||.|..:    .
plant   265 IASERIIPGYGGGMSSAKAALESDTRVLAYEAGRKSNIRVNTISAGPLGSRAAKAIGFID----T 325

  Fly   213 FLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGGKQVM 261
            .:|:|.....:.:.....||..|..||||.|||.:||.|:.||.|...|
plant   326 MIEYSYNNGPIQKTLTADEVGNAAAFLASPLASAITGATIYVDNGLNAM 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 69/297 (23%)
NADB_Rossmann 11..261 CDD:304358 68/297 (23%)
MOD1NP_565331.1 PLN02730 86..388 CDD:178331 72/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D913128at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.