DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and MGC147226

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_012816817.1 Gene:MGC147226 / 780086 XenbaseID:XB-GENE-5822220 Length:521 Species:Xenopus tropicalis


Alignment Length:266 Identity:77/266 - (28%)
Similarity:126/266 - (47%) Gaps:14/266 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GSKGKAGLD---FSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHE 63
            |.||.:.||   ..|:|..:||...|||.|.|....:.||.:|:||...|....|.......|.:
 Frog   262 GYKGLSILDRMRLDGRVAYVTGGGQGIGRAFAHALGEAGAKVAVVDLMLEKAEAVAFELQVKGIK 326

  Fly    64 PYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFY 128
            ...||.|:.|..:::.|.......: |::|:..|.|||......:.|.|..:......|:|..|.
 Frog   327 SVAIAADISKEEDVKRIVDTIVTNW-GRIDIACNNAGINMNSASEDTTLEEWDKTFSVNLRGLFM 390

  Fly   129 LTKLL-LPQLLQCKGSIVNVSSVCGLRAFPN---LVAYNMSKAAVDQFTRSLALDLGPQGVRVNA 189
            ..:.. ...|.|..|.|:|.:|:..| ..|:   .:|||.|||.|.:.|::|..:...:|||||.
 Frog   391 CCQAAGRVMLSQGYGKIINTASMASL-IVPHPQKQLAYNTSKAGVVKLTQTLGTEWIDRGVRVNC 454

  Fly   190 VNPGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPV 254
            ::||::.|.|     :...:....::........||:.:..::.|.:.|||||.:.::||..|.:
 Frog   455 ISPGIVDTPL-----IHSDALKPLVQRWLNDIPAGRLAQVTDLQAGVVFLASEASDYMTGHNLVI 514

  Fly   255 DGGKQV 260
            :||:.:
 Frog   515 EGGQSL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 72/254 (28%)
NADB_Rossmann 11..261 CDD:304358 72/254 (28%)
MGC147226XP_012816817.1 AdoMet_MTases 78..241 CDD:388410
NADB_Rossmann 269..518 CDD:389744 73/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.