DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Hsdl2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_077217.2 Gene:Hsdl2 / 72479 MGIID:1919729 Length:490 Species:Mus musculus


Alignment Length:221 Identity:58/221 - (26%)
Similarity:88/221 - (39%) Gaps:48/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEE----------------------GLICVM 54
            :|..|.||||:.|||.|.|...:|.||.:.:..:..:                      .|.||:
Mouse     9 AGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTTQKHPKLLGTIYTAAEEIEAAGGTALPCVV 73

  Fly    55 KRCMKMGHEPYGIAGDLLKPPEIECIARKTTERYEGKLDVLVNGA-GIMPTGTLQSTELACFTHV 118
                           |:....:|.....|..|:: |.:|:|||.| .|..|.|| .|.......:
Mouse    74 ---------------DVRDEQQINSAVEKAVEKF-GGIDILVNNASAISLTNTL-DTPTKRVDLM 121

  Fly   119 MEANVRSGFYLTKLLLPQLLQCK-GSIVNVSSVCGLRA--FPNLVAYNMSKAAVDQFTRSLALDL 180
            |..|.|..:..:|..:|.|.:.| |.|:|:|....|..  |....||.::|..:......:|.:.
Mouse   122 MNVNTRGTYLTSKACIPFLKKSKVGHILNLSPPLNLNPLWFKQHCAYTIAKYGMSMCVLGMAEEF 186

  Fly   181 GPQGVRVNAVNPGVIRTNLQKAGGMD 206
            ..: :.|||:.|   ||.:..| .||
Mouse   187 RGE-IAVNALWP---RTAIHTA-AMD 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 58/221 (26%)
NADB_Rossmann 11..261 CDD:304358 58/221 (26%)
Hsdl2NP_077217.2 HSDL2_SDR_c 8..248 CDD:187663 58/221 (26%)
adh_short 12..197 CDD:278532 51/202 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..370
SCP2 390..483 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.