DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Dhrs2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_082066.2 Gene:Dhrs2 / 71412 MGIID:1918662 Length:282 Species:Mus musculus


Alignment Length:260 Identity:81/260 - (31%)
Similarity:131/260 - (50%) Gaps:33/260 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGL---ICVMKRCMKMGHEPYGIAGDLLK 73
            :|||.:|||:..|||.|.|...::.||.:.:..|::|.:   :.::|      .|...:.|.:  
Mouse    36 AGKVAVITGSTRGIGFAIARRLAQDGAHVVISSRKQENVDEAVTILK------EEGLSVTGTM-- 92

  Fly    74 PPEIECIARKTTER---------YEGKLDVLVNGAGIMPT--GTLQSTELACFTHVMEANVRSGF 127
                 |...|..:|         :.|.:|.||..||:.|.  .||.::| ..:..:::.||:|..
Mouse    93 -----CHVGKAEDRQHLVTTALKHSGGIDFLVCVAGVNPLVGSTLGASE-QIWDKILDVNVKSPA 151

  Fly   128 YLTKLLLPQLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVN 191
            .|...:||.:...: ||:|.|||.......|.|..||.||.|:....:|||::|.|:|:|||.:.
Mouse   152 LLLSKVLPYMENRRGGSVVLVSSGVAYVPVPKLGVYNTSKTALLGLCKSLAVELAPKGIRVNCLV 216

  Fly   192 PGVIRTNLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDG 256
            ||:|:|:.    .:.|::....|....|...:.|:|||:|.|..:.||.|..||::||..:.|.|
Mouse   217 PGIIKTDF----SLREKTMPNMLPDMNKIFGVKRLGEPEECAGLVSFLCSSDASYITGENIMVAG 277

  Fly   257  256
            Mouse   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 81/260 (31%)
NADB_Rossmann 11..261 CDD:304358 81/260 (31%)
Dhrs2NP_082066.2 NADB_Rossmann 35..277 CDD:389744 80/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830587
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.