DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Bdh2

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001165526.1 Gene:Bdh2 / 69772 MGIID:1917022 Length:255 Species:Mus musculus


Alignment Length:255 Identity:89/255 - (34%)
Similarity:132/255 - (51%) Gaps:28/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 GKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMGHEPY-GIAG---DLLK 73
            |||:::|.||.|||.|:|..|::.||.:...|..|..|         ...|.| ||..   |:.|
Mouse    16 GKVIVLTAAAQGIGRASALAFAREGAKVIATDINESKL---------QELESYRGIQTRVLDVTK 71

  Fly    74 PPEIECIARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLPQLL 138
            ..:|:..|.:..     ::|||.|.||.:..||:...|...:...|..||||.|.:.|..||::|
Mouse    72 KRQIDQFASEIE-----RIDVLFNVAGFVHHGTILDCEEKDWDFSMNLNVRSMFLMIKAFLPKML 131

  Fly   139 -QCKGSIVNVSSVC-GLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRT-NLQ 200
             |..|:|:|:|||. .::...|...|:.:||||...|:|:|.|...||:|.|.|.||.:.| :||
Mouse   132 AQKSGNIINMSSVASSIKGVENRCVYSATKAAVIGLTKSVAADFIQQGIRCNCVCPGTVDTPSLQ 196

  Fly   201 ---KAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGVTLPVDGG 257
               :|....:::...||...|    .||....:|||....:|||:.:::|||..:.:|||
Mouse   197 ERIQARDNPKEALKTFLNRQK----TGRFASAEEVALLCVYLASDESAYVTGNPVIIDGG 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 87/253 (34%)
NADB_Rossmann 11..261 CDD:304358 89/255 (35%)
Bdh2NP_001165526.1 PRK06138 12..254 CDD:235712 89/255 (35%)
DHRS6_like_SDR_c 15..255 CDD:187626 89/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.