DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Dhrs7c

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_001013031.2 Gene:Dhrs7c / 68460 MGIID:1915710 Length:311 Species:Mus musculus


Alignment Length:193 Identity:60/193 - (31%)
Similarity:90/193 - (46%) Gaps:13/193 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKRCMKMG-----HEPYGIAGDLLK 73
            |||:||.|.||:|...|.:|...||.|.|..:..|||..:......:.     ..|..:..||  
Mouse    38 KVVVITDAISGLGKECARVFHAGGARLVLCGKNWEGLESLYATLTSVADPSKTFTPKLVLLDL-- 100

  Fly    74 PPEIEC---IARKTTERYEGKLDVLVNGAGIMPTGTLQSTELACFTHVMEANVRSGFYLTKLLLP 135
             .:|.|   :|::..:.| |.:|:|:|.|.:...|......|.....:|:||......|||:|||
Mouse   101 -SDISCVQDVAKEVLDCY-GCVDILINNASVKVKGPAHKISLELDKKIMDANYFGPITLTKVLLP 163

  Fly   136 QLLQCK-GSIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAVNPGVIRT 197
            .::..: |.||.|:::......|...||..||.||..|...|..::....|.|:.|:|..||:
Mouse   164 NMISRRTGQIVLVNNIQAKFGIPFRTAYAASKHAVMGFFDCLRAEVEEYDVVVSTVSPTFIRS 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 60/193 (31%)
NADB_Rossmann 11..261 CDD:304358 60/193 (31%)
Dhrs7cNP_001013031.2 11beta-HSD1_like_SDR_c 35..296 CDD:187593 60/193 (31%)
PRK06181 37..293 CDD:235726 60/193 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.