DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31546 and Decr1

DIOPT Version :9

Sequence 1:NP_730973.1 Gene:CG31546 / 40691 FlyBaseID:FBgn0051546 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_080448.1 Gene:Decr1 / 67460 MGIID:1914710 Length:335 Species:Mus musculus


Alignment Length:270 Identity:70/270 - (25%)
Similarity:119/270 - (44%) Gaps:41/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FSGKVVLITGAASGIGAAAAEMFSKLGACLALVDREEEGLICVMKR-----CMKMGHEPYGIAGD 70
            |.|||..|||..:|:|.|.....|.|||...:..|.    |.|:|.     ..|.|::.:.|..|
Mouse    57 FQGKVAFITGGGTGLGKAMTTFLSTLGAQCVIASRN----IDVLKATAEEISSKTGNKVHAIRCD 117

  Fly    71 LLKPPEI-----ECIARKTTERYEGKLDVLVNGAG---IMPTGTLQSTELACFTHVMEANVRSGF 127
            :..|..:     |.|      :..|..||::|.|.   |.|:..|........|.::   :....
Mouse   118 VRDPDMVHNTVLELI------KVAGHPDVVINNAAGNFISPSERLTPNGWKTITDIV---LNGTA 173

  Fly   128 YLTKLLLPQLLQC-KG-SIVNVSSVCGLRAFPNLVAYNMSKAAVDQFTRSLALDLGPQGVRVNAV 190
            |:|..:..||::. || :.:.::::........::..:.:|:.|:...:|||.:.|..|:|.|.:
Mouse   174 YVTLEIGKQLIKAQKGAAFLAITTIYAESGSGFVMPSSSAKSGVEAMNKSLAAEWGRYGMRFNII 238

  Fly   191 NPGVIRT-----NLQKAGGMDEQSYAEFLEHSKKTHALGRIGEPKEVAAAICFLASELASFVTGV 250
            .||.|:|     .|...|..:::.....        ..||:|..:|:|....||.|:.||::.|.
Mouse   239 QPGPIKTKGAFSRLDPTGRFEKEMIDRI--------PCGRLGTMEELANLATFLCSDYASWINGA 295

  Fly   251 TLPVDGGKQV 260
            .:..|||::|
Mouse   296 VIRFDGGEEV 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31546NP_730973.1 fabG 9..257 CDD:235975 67/265 (25%)
NADB_Rossmann 11..261 CDD:304358 70/270 (26%)
Decr1NP_080448.1 TER_DECR_SDR_a 57..303 CDD:187627 68/266 (26%)
PRK07677 59..303 CDD:181077 67/264 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0725
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.